PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn271611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 283aa    MW: 31302.1 Da    PI: 4.3567
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn271611genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.77.3e-072132462255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 ++ +++ee+ +L++ +gL ++q+ +WF N+R ++
  Achn271611 213 KHLLQEEEKMKLSEITGLGQKQINNWFINQRKRH 246
                 677899*************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.3E-205498IPR005540KNOX1
PfamPF037901.1E-205696IPR005540KNOX1
SMARTSM012564.7E-24101152IPR005541KNOX2
PfamPF037911.6E-23105151IPR005541KNOX2
SMARTSM003890.0019187253IPR001356Homeobox domain
CDDcd000861.60E-8211250No hitNo description
SuperFamilySSF466894.71E-10213260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-14216251IPR009057Homeodomain-like
PROSITE profilePS500719.394218249IPR001356Homeobox domain
PfamPF059204.7E-9218245IPR008422Homeobox KN domain
PROSITE patternPS000270224247IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDELYRLHST ISCLDDVSGV GTFSTNMSGL HGPIGDMDRF ETVGMEVAGS GMSDLIKAQI  60
ANHPLYPNLV SAYIECRKVG APPEMASLLE EISKENNPIS SRCEIGVDPE LDEFMESYFE  120
VLHKYKEELS KPFDEATTFL SDIESQLSNL CKETLTMGRT YHSDEEAGTS SEDLSCGEVE  180
AAESQESSGA RPGDQELKEM LLRKISSSVI KNKHLLQEEE KMKLSEITGL GQKQINNWFI  240
NQRKRHWKPS EDMRFALMEG VSGSMGGPMY FDNTGGTSSV DI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277931.21e-117PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP297e-77KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA5C7Q81e-121A5C7Q8_VITVI; Putative uncharacterized protein
STRINGVIT_14s0060g01180.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.18e-62KNOTTED1-like homeobox gene 6